Lineage for d1fcda2 (1fcd A:115-255)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20986Protein Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit [51966] (1 species)
  7. 20987Species Purple phototrophic bacterium (Chromatium vinosum) [TaxId:1049] [51967] (1 PDB entry)
  8. 20989Domain d1fcda2: 1fcd A:115-255 [30594]
    Other proteins in same PDB: d1fcda3, d1fcdb3, d1fcdc1, d1fcdc2, d1fcdd1, d1fcdd2

Details for d1fcda2

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution

SCOP Domain Sequences for d1fcda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum)}
gyseeaaaklphawkageqtailrkqledmadggtvviappaapfrcppgpyerasqvay
ylkahkpmskviildssqtfskqsqfskgwerlygfgtenamiewhpgpdsavvkvdgge
mmvetafgdefkadvinlipp

SCOP Domain Coordinates for d1fcda2:

Click to download the PDB-style file with coordinates for d1fcda2.
(The format of our PDB-style files is described here.)

Timeline for d1fcda2: