Lineage for d1fcdc1 (1fcd C:1-80)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 1206Family a.3.1.4: Two-domain cytochrome c [46680] (2 proteins)
  6. 1213Protein Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit [46683] (1 species)
  7. 1214Species Purple phototrophic bacterium (Chromatium vinosum) [TaxId:1049] [46684] (1 PDB entry)
  8. 1215Domain d1fcdc1: 1fcd C:1-80 [15966]
    Other proteins in same PDB: d1fcda1, d1fcda2, d1fcda3, d1fcdb1, d1fcdb2, d1fcdb3

Details for d1fcdc1

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution

SCOP Domain Sequences for d1fcdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcdc1 a.3.1.4 (C:1-80) Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit {Purple phototrophic bacterium (Chromatium vinosum)}
eptaemltnncagchgthgnsvgpaspsiaqmdpmvfvevmegfksgeiastimgriakg
ystadfekmagyfkqqtyqp

SCOP Domain Coordinates for d1fcdc1:

Click to download the PDB-style file with coordinates for d1fcdc1.
(The format of our PDB-style files is described here.)

Timeline for d1fcdc1: