![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Dihydrolipoamide dehydrogenase [51959] (8 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [51963] (1 PDB entry) |
![]() | Domain d1ebdb2: 1ebd B:155-271 [30580] Other proteins in same PDB: d1ebda3, d1ebdb3, d1ebdc_ complexed with fad |
PDB Entry: 1ebd (more details), 2.6 Å
SCOPe Domain Sequences for d1ebdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebdb2 c.3.1.5 (B:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} pnfkfsnrildstgalnlgevpkslvvigggyigielgtayanfgtkvtilegageilsg fekqmaaiikkrlkkkgvevvtnalakgaeeredgvtvtyeangetktidadyvlvt
Timeline for d1ebdb2:
![]() Domains from other chains: (mouse over for more information) d1ebda1, d1ebda2, d1ebda3, d1ebdc_ |