Lineage for d1ebdb2 (1ebd B:155-271)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20953Protein Dihydrolipoamide dehydrogenase [51959] (6 species)
  7. 20959Species Bacillus stearothermophilus [TaxId:1422] [51963] (1 PDB entry)
  8. 20963Domain d1ebdb2: 1ebd B:155-271 [30580]
    Other proteins in same PDB: d1ebda3, d1ebdb3, d1ebdc_

Details for d1ebdb2

PDB Entry: 1ebd (more details), 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase

SCOP Domain Sequences for d1ebdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebdb2 c.3.1.5 (B:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus}
pnfkfsnrildstgalnlgevpkslvvigggyigielgtayanfgtkvtilegageilsg
fekqmaaiikkrlkkkgvevvtnalakgaeeredgvtvtyeangetktidadyvlvt

SCOP Domain Coordinates for d1ebdb2:

Click to download the PDB-style file with coordinates for d1ebdb2.
(The format of our PDB-style files is described here.)

Timeline for d1ebdb2: