Lineage for d1ebda2 (1ebd A:155-271)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 978527Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 978528Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 978992Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 979009Protein Dihydrolipoamide dehydrogenase [51959] (8 species)
  7. 979015Species Bacillus stearothermophilus [TaxId:1422] [51963] (1 PDB entry)
  8. 979017Domain d1ebda2: 1ebd A:155-271 [30578]
    Other proteins in same PDB: d1ebda3, d1ebdb3, d1ebdc_
    complexed with fad

Details for d1ebda2

PDB Entry: 1ebd (more details), 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1ebda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
pnfkfsnrildstgalnlgevpkslvvigggyigielgtayanfgtkvtilegageilsg
fekqmaaiikkrlkkkgvevvtnalakgaeeredgvtvtyeangetktidadyvlvt

SCOPe Domain Coordinates for d1ebda2:

Click to download the PDB-style file with coordinates for d1ebda2.
(The format of our PDB-style files is described here.)

Timeline for d1ebda2: