Lineage for d1ebdb2 (1ebd B:155-271)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. Protein Dihydrolipoamide dehydrogenase, middle domain [418939] (7 species)
  7. Species Bacillus stearothermophilus [TaxId:1422] [419381] (1 PDB entry)
  8. 2849906Domain d1ebdb2: 1ebd B:155-271 [30580]
    Other proteins in same PDB: d1ebda1, d1ebda3, d1ebdb1, d1ebdb3, d1ebdc_
    complexed with fad

Details for d1ebdb2

PDB Entry: 1ebd (more details), 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase
PDB Compounds: (B:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1ebdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebdb2 c.3.1.5 (B:155-271) Dihydrolipoamide dehydrogenase, middle domain {Bacillus stearothermophilus [TaxId: 1422]}
pnfkfsnrildstgalnlgevpkslvvigggyigielgtayanfgtkvtilegageilsg
fekqmaaiikkrlkkkgvevvtnalakgaeeredgvtvtyeangetktidadyvlvt

SCOPe Domain Coordinates for d1ebdb2:

Click to download the PDB-style file with coordinates for d1ebdb2.
(The format of our PDB-style files is described here.)

Timeline for d1ebdb2: