Lineage for d2npx_2 (2npx 120-242)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins) 
Protein NADH peroxidase [51955] (1 species) Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries) 
Domain d2npx_2: 2npx 120-242 [30560]
Other proteins in same PDB: d2npx_3
Details for d2npx_2
PDB Entry: 2npx (more details), 2.4 Å
PDB Description: nadh binding site and catalysis of nadh peroxidase
SCOP Domain Sequences for d2npx_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2npx_2 c.3.1.5 (120-242) NADH peroxidase {Enterococcus faecalis}
ipgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvid
ildrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvv
vav
SCOP Domain Coordinates for d2npx_2:
Click to download the PDB-style file with coordinates for d2npx_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2npx_2:
- d2npx_2 appears in SCOP 1.57
- d2npx_2 appears in the current release, SCOPe 2.08, called d2npxa2
View in 3D
