PDB entry 2npx

View 2npx on RCSB PDB site
Description: nadh binding site and catalysis of nadh peroxidase
Deposited on 1992-05-29, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.159
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2npx_ (-)
    mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
    mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldi
    pgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvidi
    ldrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvvv
    avgvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialat
    narkqgrfavknleepvkpfpgvqgssglavfdykfastginevmaqklgketkavtvve
    dylmdfnpdkqkawfklvydpettqilgaqlmskadltaninaislaiqakmtiedlaya
    dfffqpafdkpwniintaaleavkqer