![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
![]() | Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.3: GNA1870 immunodominant domain-like [144097] (2 proteins) related to Pfam PF01298; GNA1870 is a bacterial cell surface-exposed lipoprotein |
![]() | Protein Transferrin binding protein TbpB barrel [310777] (1 species) |
![]() | Species Actinobacillus pleuropneumoniae [TaxId:715] [311033] (3 PDB entries) |
![]() | Domain d3hoea1: 3hoe A:131-285 [305521] Other proteins in same PDB: d3hoea2, d3hoeb2 |
PDB Entry: 3hoe (more details), 2.3 Å
SCOPe Domain Sequences for d3hoea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hoea1 f.4.1.3 (A:131-285) Transferrin binding protein TbpB barrel {Actinobacillus pleuropneumoniae [TaxId: 715]} kelpvnqlltytgswdftsnanlnneegrpnylnddyytkfigkrvglvsgdakpakhky tsqfevdfatkkmtgklsdkektiytvnadirgnrftgaatasdknkgkgesynffsads qsleggfygpkaeemagkfvandkslfavfsakhn
Timeline for d3hoea1: