Lineage for d3hoeb2 (3hoe B:44-130)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434508Fold b.181: Handle domain of Transferrin binding protein TbpB-like [310564] (1 superfamily)
    2 layers; antiparallel B-sheet, order 1432 or 216543, flanked by alpha helix or 2-strand beta hairpin
  4. 2434509Superfamily b.181.1: Handle domain of Transferrin binding protein TbpB-like [310592] (2 families) (S)
    C-terminal part of Pfam PF01298
  5. 2434510Family b.181.1.1: Handle domain of Transferrin binding protein TbpB-like [310639] (1 protein)
  6. 2434511Protein Handle domain of Transferrin binding protein TbpB [310778] (1 species)
  7. 2434512Species Actinobacillus pleuropneumoniae [TaxId:715] [311034] (3 PDB entries)
  8. 2434516Domain d3hoeb2: 3hoe B:44-130 [305524]
    Other proteins in same PDB: d3hoea1, d3hoeb1

Details for d3hoeb2

PDB Entry: 3hoe (more details), 2.3 Å

PDB Description: Crystal Structure of Surface Lipoprotein
PDB Compounds: (B:) TbpB

SCOPe Domain Sequences for d3hoeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hoeb2 b.181.1.1 (B:44-130) Handle domain of Transferrin binding protein TbpB {Actinobacillus pleuropneumoniae [TaxId: 715]}
epalgyvvkvpvssfenkkvdisdievitngnlddvpykansskynypdiktkdsslqyv
rsgyvidgehsgsnekgyvyykgnspa

SCOPe Domain Coordinates for d3hoeb2:

Click to download the PDB-style file with coordinates for d3hoeb2.
(The format of our PDB-style files is described here.)

Timeline for d3hoeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hoeb1