SCOPe 2.07: Domain d3hoeb1: 3hoe B:131-285

Lineage for d3hoeb1 (3hoe B:131-285)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.3: GNA1870 immunodominant domain-like [144097] (2 proteins)
   related to Pfam PF01298; GNA1870 is a bacterial cell surface-exposed lipoprotein

6. Protein Transferrin binding protein TbpB barrel [310777] (1 species)

7. Species Actinobacillus pleuropneumoniae [TaxId:715] [311033] (3 PDB entries)

8. Domain d3hoeb1: 3hoe B:131-285 [305523]
   Other proteins in same PDB: d3hoea2, d3hoeb2

Details for d3hoeb1

PDB Entry: 3hoe, 2.3 Å

PDB Description: Crystal Structure of Surface Lipoprotein

PDB Compounds: (B:) TbpB

SCOPe Domain Sequences for d3hoeb1:

Sequence; same for both SEQRES and ATOM records:

>d3hoeb1 f.4.1.3 (B:131-285) Transferrin binding protein TbpB barrel {Actinobacillus pleuropneumoniae [TaxId: 715]}
kelpvnqlltytgswdftsnanlnneegrpnylnddyytkfigkrvglvsgdakpakhky
tsqfevdfatkkmtgklsdkektiytvnadirgnrftgaatasdknkgkgesynffsads
qsleggfygpkaeemagkfvandkslfavfsakhn

Timeline for d3hoeb1:

• d3hoeb1 first appeared in SCOPe 2.06
  
• d3hoeb1 appears in the current release, SCOPe 2.08