Lineage for d3hoea1 (3hoe A:131-285)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251384Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2251415Family f.4.1.3: GNA1870 immunodominant domain-like [144097] (2 proteins)
    related to Pfam PF01298; GNA1870 is a bacterial cell surface-exposed lipoprotein
  6. 2251419Protein Transferrin binding protein TbpB barrel [310777] (1 species)
  7. 2251420Species Actinobacillus pleuropneumoniae [TaxId:715] [311033] (3 PDB entries)
  8. 2251423Domain d3hoea1: 3hoe A:131-285 [305521]
    Other proteins in same PDB: d3hoea2, d3hoeb2

Details for d3hoea1

PDB Entry: 3hoe (more details), 2.3 Å

PDB Description: Crystal Structure of Surface Lipoprotein
PDB Compounds: (A:) TbpB

SCOPe Domain Sequences for d3hoea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hoea1 f.4.1.3 (A:131-285) Transferrin binding protein TbpB barrel {Actinobacillus pleuropneumoniae [TaxId: 715]}
kelpvnqlltytgswdftsnanlnneegrpnylnddyytkfigkrvglvsgdakpakhky
tsqfevdfatkkmtgklsdkektiytvnadirgnrftgaatasdknkgkgesynffsads
qsleggfygpkaeemagkfvandkslfavfsakhn

SCOPe Domain Coordinates for d3hoea1:

Click to download the PDB-style file with coordinates for d3hoea1.
(The format of our PDB-style files is described here.)

Timeline for d3hoea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hoea2