Lineage for d1geub2 (1geu B:147-262)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20992Protein Glutathione reductase [51944] (2 species)
  7. 20993Species Escherichia coli [TaxId:562] [51946] (4 PDB entries)
  8. 21009Domain d1geub2: 1geu B:147-262 [30488]
    Other proteins in same PDB: d1geua3, d1geub3

Details for d1geub2

PDB Entry: 1geu (more details), 2.2 Å

PDB Description: anatomy of an engineered nad-binding site

SCOP Domain Sequences for d1geub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1geub2 c.3.1.5 (B:147-262) Glutathione reductase {Escherichia coli}
dipgveygidsdgffalpalpervavvgagyigvelggvinglgakthlfemfdaplpsf
dpmisetlvevmnaegpqlhtnaipkavvkntdgsltleledgrsetvdcliwaig

SCOP Domain Coordinates for d1geub2:

Click to download the PDB-style file with coordinates for d1geub2.
(The format of our PDB-style files is described here.)

Timeline for d1geub2: