Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins) |
Protein Glutathione reductase [51944] (2 species) |
Species Escherichia coli [TaxId:562] [51946] (4 PDB entries) |
Domain d1geub2: 1geu B:147-262 [30488] Other proteins in same PDB: d1geua3, d1geub3 |
PDB Entry: 1geu (more details), 2.2 Å
SCOP Domain Sequences for d1geub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1geub2 c.3.1.5 (B:147-262) Glutathione reductase {Escherichia coli} dipgveygidsdgffalpalpervavvgagyigvelggvinglgakthlfemfdaplpsf dpmisetlvevmnaegpqlhtnaipkavvkntdgsltleledgrsetvdcliwaig
Timeline for d1geub2: