Lineage for d1geub2 (1geu B:147-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849979Protein Glutathione reductase, middle domain [418943] (3 species)
  7. Species Escherichia coli [TaxId:562] [419395] (4 PDB entries)
  8. 2849988Domain d1geub2: 1geu B:147-262 [30488]
    Other proteins in same PDB: d1geua1, d1geua3, d1geub1, d1geub3
    complexed with fad, nad

Details for d1geub2

PDB Entry: 1geu (more details), 2.2 Å

PDB Description: anatomy of an engineered nad-binding site
PDB Compounds: (B:) glutathione reductase

SCOPe Domain Sequences for d1geub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1geub2 c.3.1.5 (B:147-262) Glutathione reductase, middle domain {Escherichia coli [TaxId: 562]}
dipgveygidsdgffalpalpervavvgagyigvelggvinglgakthlfemfdaplpsf
dpmisetlvevmnaegpqlhtnaipkavvkntdgsltleledgrsetvdcliwaig

SCOPe Domain Coordinates for d1geub2:

Click to download the PDB-style file with coordinates for d1geub2.
(The format of our PDB-style files is described here.)

Timeline for d1geub2: