Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins) |
Protein p-Hydroxybenzoate hydroxylase (PHBH) [51917] (2 species) |
Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries) |
Domain d1bgj_1: 1bgj 1-173,276-391 [30352] Other proteins in same PDB: d1bgj_2 |
PDB Entry: 1bgj (more details), 3 Å
SCOP Domain Sequences for d1bgj_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bgj_1 c.3.1.2 (1-173,276-391) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens} mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfrgisrqsipaerXmqhgrl flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye
Timeline for d1bgj_1: