SCOP 1.55: Domain d1bgj_2: 1bgj 174-275

Lineage for d1bgj_2 (1bgj 174-275)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)

5. Family d.16.1.2: PHBH-like [54378] (2 proteins)

6. Protein p-Hydroxybenzoate hydroxylase, PHBH [54379] (2 species)

7. Species Pseudomonas fluorescens [TaxId:294] [54380] (17 PDB entries)

8. Domain d1bgj_2: 1bgj 174-275 [37883]
   Other proteins in same PDB: d1bgj_1

Details for d1bgj_2

PDB Entry: 1bgj, 3 Å

PDB Description: p-hydroxybenzoate hydroxylase (phbh) mutant with cys 116 replaced by ser (c116s) and his 162 replaced by arg (h162r), in complex with fad and 4-hydroxybenzoic acid

SCOP Domain Sequences for d1bgj_2:

Sequence; same for both SEQRES and ATOM records:

>d1bgj_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas fluorescens}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekved
wsderfwtelkarlpaevaeklvtgpsleksiaplrsfvvep

Timeline for d1bgj_2:

• d1bgj_2 appears in SCOP 1.57
  
• d1bgj_2 appears in the current release, SCOPe 2.08, called d1bgja2