SCOPe 2.08: Domain d1scua1: 1scu A:1-121

Lineage for d1scua1 (1scu A:1-121)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)

7. Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)

8. Domain d1scua1: 1scu A:1-121 [30307]
   Other proteins in same PDB: d1scua2, d1scub1, d1scub2, d1scud2, d1scue1, d1scue2
   complexed with coa

Details for d1scua1

PDB Entry: 1scu, 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

PDB Compounds: (A:) succinyl-coa synthetase, alpha subunit

SCOPe Domain Sequences for d1scua1:

Sequence; same for both SEQRES and ATOM records:

>d1scua1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

Timeline for d1scua1:

• d1scua1 first appeared (with stable ids) in SCOP 1.55
  
• d1scua1 appears in SCOPe 2.07