SCOPe 2.08: Domain d1scue1: 1scu E:239-388

Lineage for d1scue1 (1scu E:239-388)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)

7. Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)

8. Domain d1scue1: 1scu E:239-388 [31146]
   Other proteins in same PDB: d1scua1, d1scua2, d1scub2, d1scud1, d1scud2, d1scue2
   complexed with coa

Details for d1scue1

PDB Entry: 1scu, 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

PDB Compounds: (E:) succinyl-coa synthetase, beta subunit

SCOPe Domain Sequences for d1scue1:

Sequence; same for both SEQRES and ATOM records:

>d1scue1 c.23.4.1 (E:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaavegk

Timeline for d1scue1:

• d1scue1 first appeared (with stable ids) in SCOP 1.55
  
• d1scue1 appears in SCOPe 2.07