SCOP 1.55: Domain d1scue1: 1scu E:239-388

Lineage for d1scue1 (1scu E:239-388)

Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
Species Escherichia coli [TaxId:562] [52216] (4 PDB entries)
Domain d1scue1: 1scu E:239-388 [31146]
Other proteins in same PDB: d1scua1, d1scua2, d1scub2, d1scud1, d1scud2, d1scue2

Details for d1scue1

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

SCOP Domain Sequences for d1scue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scue1 c.23.4.1 (E:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaavegk

SCOP Domain Coordinates for d1scue1:

Click to download the PDB-style file with coordinates for d1scue1.
(The format of our PDB-style files is described here.)

Timeline for d1scue1: