Lineage for d1ee9a1 (1ee9 A:149-319)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins) 
Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51897] (2 PDB entries) 
Domain d1ee9a1: 1ee9 A:149-319 [30288]
Other proteins in same PDB: d1ee9a2
Details for d1ee9a1
PDB Entry: 1ee9 (more details), 3 Å
PDB Description: crystal structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae complexed with nad
SCOP Domain Sequences for d1ee9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee9a1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae)}
pctplaivkileflkiynnllpegnrlygkkcivinrseivgrplaallandgatvysvd
vnniqkftrgeslklnkhhvedlgeysedllkkcsldsdvvitgvpsenykfpteyikeg
avcinfactknfsddvkekaslyvpmtgkvtiamllrnmlrlvrnvelske
SCOP Domain Coordinates for d1ee9a1:
Click to download the PDB-style file with coordinates for d1ee9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ee9a1:
- d1ee9a1 appears in SCOP 1.57
- d1ee9a1 appears in the current release, SCOPe 2.08
View in 3D
