Lineage for d1ee9a2 (1ee9 A:3-148)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) 
Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein) Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53239] (2 PDB entries) 
Domain d1ee9a2: 1ee9 A:3-148 [33936]
Other proteins in same PDB: d1ee9a1
Details for d1ee9a2
PDB Entry: 1ee9 (more details), 3 Å
PDB Description: crystal structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae complexed with nad
SCOP Domain Sequences for d1ee9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee9a2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae)}
kpgrtilaskvaetfnteiinnveeykkthngqgpllvgflanndpaakmyatwtqktse
smgfrydlrviedkdfleeaiiqangddsvngimvyfpvfgnaqdqylqqvvckekdveg
lnhvyyqnlyhnvryldkenrlksil
SCOP Domain Coordinates for d1ee9a2:
Click to download the PDB-style file with coordinates for d1ee9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ee9a2:
- d1ee9a2 appears in SCOP 1.57
- d1ee9a2 appears in the current release, SCOPe 2.08
View in 3D
