SCOPe 2.07: Domain d1o2ca1: 1o2c A:2-100

Lineage for d1o2ca1 (1o2c A:2-100)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.4: DUF190/COG1993 [89934] (1 protein)
   automatically mapped to Pfam PF02641

6. Protein Hypothetical protein TM0021 [89935] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89936] (2 PDB entries)

8. Domain d1o2ca1: 1o2c A:2-100 [302803]
   Other proteins in same PDB: d1o2ca2
   automated match to d1o51a_
   complexed with adp, so4

Details for d1o2ca1

PDB Entry: 1o2c, 2.5 Å

PDB Description: Crystal structure of hypothetical protein (TM0021) from Thermotoga maritima at 2.50 A resolution

PDB Compounds: (A:) Hypothetical protein TM0021

SCOPe Domain Sequences for d1o2ca1:

Sequence, based on SEQRES records:

>d1o2ca1 d.58.5.4 (A:2-100) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]}
kllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghkrhmhrsdffslspd
lpivleivdeeerinlflkeidnidfdglvftadvnvvk

Sequence, based on observed residues (ATOM records):

>d1o2ca1 d.58.5.4 (A:2-100) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]}
kllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghpdlpivleivdeeer
inlflkeidnidfdglvftadvnvvk

Timeline for d1o2ca1:

• d1o2ca1 first appeared in SCOPe 2.06
  
• d1o2ca1 appears in the current release, SCOPe 2.08