PDB entry 1o2c

View 1o2c on RCSB PDB site
Description: Crystal structure of hypothetical protein (TM0021) from Thermotoga maritima at 2.50 A resolution
Class: structural genomics, unknown function
Keywords: tm0021, hypothetical protein, structural genomics, jcsg
Deposited on 2003-02-27, released 2003-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-08-19, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein TM0021
    Species: Thermotoga maritima
    Gene: TM0021
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXM9
      • leader sequence (10-12)
      • modified residue (43)
      • modified residue (53)
    Domains in SCOPe 2.07: d1o2ca1, d1o2ca2
  • Heterogens: SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1o2cA (A:)
mgsdkihhhhhhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghkr
hmhrsdffslspdlpivleivdeeerinlflkeidnidfdglvftadvnvvkmg

    Sequence, based on observed residues (ATOM records): (download) 
    >1o2cA (A:)
hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghpdlpivleivde
eerinlflkeidnidfdglvftadvnvvk