Lineage for d1o2ca1 (1o2c A:2-100)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517841Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2518127Family d.58.5.4: DUF190/COG1993 [89934] (1 protein)
    automatically mapped to Pfam PF02641
  6. 2518128Protein Hypothetical protein TM0021 [89935] (1 species)
  7. 2518129Species Thermotoga maritima [TaxId:2336] [89936] (2 PDB entries)
  8. 2518130Domain d1o2ca1: 1o2c A:2-100 [302803]
    Other proteins in same PDB: d1o2ca2
    automated match to d1o51a_
    complexed with adp, so4

Details for d1o2ca1

PDB Entry: 1o2c (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical protein (TM0021) from Thermotoga maritima at 2.50 A resolution
PDB Compounds: (A:) Hypothetical protein TM0021

SCOPe Domain Sequences for d1o2ca1:

Sequence, based on SEQRES records: (download)

>d1o2ca1 d.58.5.4 (A:2-100) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]}
kllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghkrhmhrsdffslspd
lpivleivdeeerinlflkeidnidfdglvftadvnvvk

Sequence, based on observed residues (ATOM records): (download)

>d1o2ca1 d.58.5.4 (A:2-100) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]}
kllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghpdlpivleivdeeer
inlflkeidnidfdglvftadvnvvk

SCOPe Domain Coordinates for d1o2ca1:

Click to download the PDB-style file with coordinates for d1o2ca1.
(The format of our PDB-style files is described here.)

Timeline for d1o2ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o2ca2