![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.4: DUF190/COG1993 [89934] (1 protein) automatically mapped to Pfam PF02641 |
![]() | Protein Hypothetical protein TM0021 [89935] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [89936] (1 PDB entry) |
![]() | Domain d1o51a_: 1o51 A: [92480] structural genomics complexed with adp, so4 |
PDB Entry: 1o51 (more details), 2.5 Å
SCOPe Domain Sequences for d1o51a_:
Sequence, based on SEQRES records: (download)
>d1o51a_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]} hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghkrhmhrsdffsl spdlpivleivdeeerinlflkeidnidfdglvftadvnvvk
>d1o51a_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]} hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghpdlpivleivde eerinlflkeidnidfdglvftadvnvvk
Timeline for d1o51a_: