SCOPe 2.08: Domain d1c0ha_: 1c0h A:

Lineage for d1c0ha_ (1c0h A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (4 PDB entries)

8. Domain d1c0ha_: 1c0h A: [302267]
   Other proteins in same PDB: d1c0hb_
   automated match to d1c40a_
   complexed with hem

Details for d1c0ha_

PDB Entry: 1c0h, 2.3 Å

PDB Description: bar-headed goose hemoglobin (aquomet form)

PDB Compounds: (A:) protein (hemoglobin (alpha chain))

SCOPe Domain Sequences for d1c0ha_:

Sequence; same for both SEQRES and ATOM records:

>d1c0ha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvvaalveavnhiddiagalsklsnlhaqklrvdpvnfkflghcflvvvaihhpsaltae
vhasldkflcavgtvltakyr

Timeline for d1c0ha_:

• d1c0ha_ first appeared in SCOPe 2.06
  
• d1c0ha_ appears in SCOPe 2.07