Lineage for d1c0hb_ (1c0h B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687018Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (4 PDB entries)
  8. 2687020Domain d1c0hb_: 1c0h B: [302268]
    Other proteins in same PDB: d1c0ha_
    automated match to d1a4fb_
    complexed with hem

Details for d1c0hb_

PDB Entry: 1c0h (more details), 2.3 Å

PDB Description: bar-headed goose hemoglobin (aquomet form)
PDB Compounds: (B:) protein (hemoglobin (beta chain))

SCOPe Domain Sequences for d1c0hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0hb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d1c0hb_:

Click to download the PDB-style file with coordinates for d1c0hb_.
(The format of our PDB-style files is described here.)

Timeline for d1c0hb_: