PDB entry 1c0h

View 1c0h on RCSB PDB site
Description: bar-headed goose hemoglobin (aquomet form)
Class: oxygen storage/transport
Keywords: oxygen transport, heme, respiratory protein, erythrocyte
Deposited on 1999-07-16, released 1999-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 1999-07-26, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin (alpha chain))
    Species: Anser indicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01990 (0-140)
      • conflict (84)
    Domains in SCOPe 2.08: d1c0ha_
  • Chain 'B':
    Compound: protein (hemoglobin (beta chain))
    Species: Anser indicus
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c0hb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0hA (A:)
    vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvvaalveavnhiddiagalsklsnlhaqklrvdpvnfkflghcflvvvaihhpsaltae
    vhasldkflcavgtvltakyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0hB (B:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpdcqaawqklvrvvahalarkyh