![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
![]() | Protein S-adenosylhomocystein hydrolase [51845] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries) |
![]() | Domain d1b3rc1: 1b3r C:190-352 [30108] Other proteins in same PDB: d1b3ra2, d1b3rb2, d1b3rc2, d1b3rd2 complexed with nad |
PDB Entry: 1b3r (more details), 2.8 Å
SCOPe Domain Sequences for d1b3rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3rc1 c.2.1.4 (C:190-352) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]} nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh
Timeline for d1b3rc1: