Lineage for d1b3ra2 (1b3r A:4-189,A:353-431)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857771Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 2857772Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 2857779Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
  8. 2857780Domain d1b3ra2: 1b3r A:4-189,A:353-431 [31366]
    Other proteins in same PDB: d1b3ra1, d1b3rb1, d1b3rc1, d1b3rd1
    complexed with nad

Details for d1b3ra2

PDB Entry: 1b3r (more details), 2.8 Å

PDB Description: rat liver s-adenosylhomocystein hydrolase
PDB Compounds: (A:) protein (s-adenosylhomocysteine hydrolase)

SCOPe Domain Sequences for d1b3ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ra2 c.23.12.3 (A:4-189,A:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
tkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkl
tkltekqaqylgmpingpfkpdhyry

SCOPe Domain Coordinates for d1b3ra2:

Click to download the PDB-style file with coordinates for d1b3ra2.
(The format of our PDB-style files is described here.)

Timeline for d1b3ra2: