Lineage for d1dapb1 (1dap B:1-118,B:269-320)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843675Protein Diaminopimelic acid dehydrogenase (DAPDH) [51819] (1 species)
  7. 2843676Species Corynebacterium glutamicum [TaxId:1718] [51820] (4 PDB entries)
  8. 2843681Domain d1dapb1: 1dap B:1-118,B:269-320 [30054]
    Other proteins in same PDB: d1dapa2, d1dapb2
    complexed with act, ndp

Details for d1dapb1

PDB Entry: 1dap (more details), 2.2 Å

PDB Description: c. glutamicum dap dehydrogenase in complex with nadp+
PDB Compounds: (B:) diaminopimelic acid dehydrogenase

SCOPe Domain Sequences for d1dapb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dapb1 c.2.1.3 (B:1-118,B:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}
mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd
vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgXr
npdftassqiafgraahrmkqqgqsgaftvlevapyllspenlddliardv

SCOPe Domain Coordinates for d1dapb1:

Click to download the PDB-style file with coordinates for d1dapb1.
(The format of our PDB-style files is described here.)

Timeline for d1dapb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dapb2