PDB entry 1dap

View 1dap on RCSB PDB site
Description: c. glutamicum dap dehydrogenase in complex with nadp+
Class: oxidoreductase
Keywords: nadp, dehydrogenase, d-amino acid dehydrogenase, lysine biosynthesis, asymmetric dimer, oxidoreductase
Deposited on 1996-07-08, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diaminopimelic acid dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: DAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dapa1, d1dapa2
  • Chain 'B':
    Compound: diaminopimelic acid dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: DAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dapb1, d1dapb2
  • Heterogens: ACT, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dapA (A:)
    mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd
    vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgwd
    pgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalekar
    rgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdseht
    gmphgghvittgdtggfnhtveyilkldrnpdftassqiafgraahrmkqqgqsgaftvl
    evapyllspenlddliardv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dapB (B:)
    mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd
    vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgwd
    pgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalekar
    rgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdseht
    gmphgghvittgdtggfnhtveyilkldrnpdftassqiafgraahrmkqqgqsgaftvl
    evapyllspenlddliardv