![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
![]() | Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species) distantly related to dihydrodipicolinate reductase larger alpha+beta subdomain substitutes for one helix and one strand of the common fold |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries) |
![]() | Domain d1dapa2: 1dap A:119-268 [39968] Other proteins in same PDB: d1dapa1, d1dapb1 complexed with act, ndp has additional subdomain(s) that are not in the common domain |
PDB Entry: 1dap (more details), 2.2 Å
SCOPe Domain Sequences for d1dapa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dapa2 d.81.1.3 (A:119-268) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse htgmphgghvittgdtggfnhtveyilkld
Timeline for d1dapa2: