Lineage for d1gyqd1 (1gyq D:1-165,D:335-358)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843784Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2844017Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51809] (5 PDB entries)
  8. 2844041Domain d1gyqd1: 1gyq D:1-165,D:335-358 [30015]
    Other proteins in same PDB: d1gyqa2, d1gyqb2, d1gyqc2, d1gyqd2
    complexed with nbd

Details for d1gyqd1

PDB Entry: 1gyq (more details), 3.4 Å

PDB Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad
PDB Compounds: (D:) protein (glyceraldehyde-3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1gyqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyqd1 c.2.1.3 (D:1-165,D:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOPe Domain Coordinates for d1gyqd1:

Click to download the PDB-style file with coordinates for d1gyqd1.
(The format of our PDB-style files is described here.)

Timeline for d1gyqd1: