SCOPe 2.08: Domain d1gyqb2: 1gyq B:166-334

Lineage for d1gyqb2 (1gyq B:166-334)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [55357] (5 PDB entries)

8. Domain d1gyqb2: 1gyq B:166-334 [39928]
   Other proteins in same PDB: d1gyqa1, d1gyqb1, d1gyqc1, d1gyqd1
   complexed with nbd

Details for d1gyqb2

PDB Entry: 1gyq, 3.4 Å

PDB Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad

PDB Compounds: (B:) protein (glyceraldehyde-3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1gyqb2:

Sequence; same for both SEQRES and ATOM records:

>d1gyqb2 d.81.1.1 (B:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

Timeline for d1gyqb2:

• d1gyqb2 first appeared (with stable ids) in SCOP 1.55
  
• d1gyqb2 appears in SCOPe 2.07