SCOPe 2.08: Domain d1bvre_: 1bvr E:

Lineage for d1bvre_ (1bvr E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (96 PDB entries)

8. Domain d1bvre_: 1bvr E: [29917]
   complexed with nad, tht

Details for d1bvre_

PDB Entry: 1bvr, 2.8 Å

PDB Description: m.tb. enoyl-acp reductase (inha) in complex with nad+ and c16-fatty- acyl-substrate

PDB Compounds: (E:) protein (enoyl-acyl carrier protein (acp) reductase)

SCOPe Domain Sequences for d1bvre_:

Sequence; same for both SEQRES and ATOM records:

>d1bvre_ c.2.1.2 (E:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

Timeline for d1bvre_:

• d1bvre_ first appeared (with stable ids) in SCOP 1.55
  
• d1bvre_ appears in SCOPe 2.07