![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins) |
![]() | Protein Enoyl-ACP reductase [51791] (3 species) |
![]() | Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (4 PDB entries) |
![]() | Domain d1bvre_: 1bvr E: [29917] |
PDB Entry: 1bvr (more details), 2.8 Å
SCOP Domain Sequences for d1bvre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvre_ c.2.1.2 (E:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA} tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt vcallsdwlpattgdiiyadggahtqll
Timeline for d1bvre_: