Lineage for d4iijf1 (4iij F:1-76)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862155Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2862156Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2862157Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)
  8. 2862309Domain d4iijf1: 4iij F:1-76 [298398]
    Other proteins in same PDB: d4iija1, d4iija2, d4iijb1, d4iijb2, d4iijc1, d4iijc2, d4iijd1, d4iijd2, d4iije_, d4iijf2, d4iijf3
    automated match to d3tiia1
    complexed with ca, cl, gdp, gtp, mes, mg

Details for d4iijf1

PDB Entry: 4iij (more details), 2.6 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-apo complex
PDB Compounds: (F:) Tubulin Tyrosine ligase, TTL

SCOPe Domain Sequences for d4iijf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iijf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d4iijf1:

Click to download the PDB-style file with coordinates for d4iijf1.
(The format of our PDB-style files is described here.)

Timeline for d4iijf1: