SCOPe 2.08: Domain d4iija2: 4iij A:246-437

Lineage for d4iija2 (4iij A:246-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d4iija2: 4iij A:246-437 [223191]
   Other proteins in same PDB: d4iija1, d4iijb1, d4iijc1, d4iijd1, d4iije_, d4iijf1, d4iijf2, d4iijf3
   automated match to d1z2ba2
   complexed with ca, cl, gdp, gtp, mes, mg

Details for d4iija2

PDB Entry: 4iij, 2.6 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-apo complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4iija2:

Sequence; same for both SEQRES and ATOM records:

>d4iija2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Timeline for d4iija2:

• d4iija2 first appeared in SCOPe 2.03
  
• d4iija2 appears in SCOPe 2.07