SCOPe 2.08: Domain d4iijd1: 4iij D:2-245

Lineage for d4iijd1 (4iij D:2-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d4iijd1: 4iij D:2-245 [223196]
   Other proteins in same PDB: d4iija2, d4iijb2, d4iijc2, d4iijd2, d4iije_, d4iijf1, d4iijf2, d4iijf3
   automated match to d1tubb1
   complexed with ca, cl, gdp, gtp, mes, mg

Details for d4iijd1

PDB Entry: 4iij, 2.6 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-apo complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4iijd1:

Sequence; same for both SEQRES and ATOM records:

>d4iijd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d4iijd1:

• d4iijd1 first appeared in SCOPe 2.03
  
• d4iijd1 appears in SCOPe 2.07