SCOPe 2.08: Domain d4iijf3: 4iij F:77-378

Lineage for d4iijf3 (4iij F:77-378)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
   Pfam PF03133; PubMed 22020298

6. Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries)

8. Domain d4iijf3: 4iij F:77-378 [343963]
   Other proteins in same PDB: d4iija1, d4iija2, d4iijb1, d4iijb2, d4iijc1, d4iijc2, d4iijd1, d4iijd2, d4iije_, d4iijf1, d4iijf2
   complexed with ca, cl, gdp, gtp, mes, mg
   fragment; missing more than one-third of the common structure and/or sequence

Details for d4iijf3

PDB Entry: 4iij, 2.6 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-apo complex

PDB Compounds: (F:) Tubulin Tyrosine ligase, TTL

SCOPe Domain Sequences for d4iijf3:

Sequence, based on SEQRES records:

>d4iijf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records):

>d4iijf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesylekplllepghrkfdirswvlvdhlyniylyregvlrt
ssepgnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfql
fgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfplaptsifikl

Timeline for d4iijf3:

• d4iijf3 first appeared in SCOPe 2.07