Lineage for d4iijf3 (4iij F:77-378)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978888Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2978889Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2978890Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries)
  8. 2979035Domain d4iijf3: 4iij F:77-378 [343963]
    Other proteins in same PDB: d4iija1, d4iija2, d4iijb1, d4iijb2, d4iijc1, d4iijc2, d4iijd1, d4iijd2, d4iije_, d4iijf1, d4iijf2
    complexed with ca, cl, gdp, gtp, mes, mg
    fragment; missing more than one-third of the common structure and/or sequence

Details for d4iijf3

PDB Entry: 4iij (more details), 2.6 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-apo complex
PDB Compounds: (F:) Tubulin Tyrosine ligase, TTL

SCOPe Domain Sequences for d4iijf3:

Sequence, based on SEQRES records: (download)

>d4iijf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d4iijf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesylekplllepghrkfdirswvlvdhlyniylyregvlrt
ssepgnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfql
fgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfplaptsifikl

SCOPe Domain Coordinates for d4iijf3:

Click to download the PDB-style file with coordinates for d4iijf3.
(The format of our PDB-style files is described here.)

Timeline for d4iijf3: