SCOPe 2.08: Domain d1oaaa_: 1oaa A:

Lineage for d1oaaa_ (1oaa A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Sepiapterin reductase [51767] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [51768] (3 PDB entries)

8. Domain d1oaaa_: 1oaa A: [29829]
   complexed with nap, oaa, so4

Details for d1oaaa_

PDB Entry: 1oaa, 1.25 Å

PDB Description: mouse sepiapterin reductase complexed with nadp and oxaloacetate

PDB Compounds: (A:) sepiapterin reductase

SCOPe Domain Sequences for d1oaaa_:

Sequence; same for both SEQRES and ATOM records:

>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]}
adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
lgllqkdtfqsgahvdfyd

Timeline for d1oaaa_:

• d1oaaa_ first appeared (with stable ids) in SCOP 1.55, called d1oaa__
  
• d1oaaa_ appears in SCOPe 2.07