Lineage for d1oaa__ (1oaa -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20277Protein Sepiapterin reductase [51767] (1 species)
  7. 20278Species Mouse (Mus musculus) [TaxId:10090] [51768] (3 PDB entries)
  8. 20279Domain d1oaa__: 1oaa - [29829]

Details for d1oaa__

PDB Entry: 1oaa (more details), 1.25 Å

PDB Description: mouse sepiapterin reductase complexed with nadp and oxaloacetate

SCOP Domain Sequences for d1oaa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaa__ c.2.1.2 (-) Sepiapterin reductase {Mouse (Mus musculus)}
adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
lgllqkdtfqsgahvdfyd

SCOP Domain Coordinates for d1oaa__:

Click to download the PDB-style file with coordinates for d1oaa__.
(The format of our PDB-style files is described here.)

Timeline for d1oaa__: