![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein Quinone oxidoreductase [51747] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [51748] (1 PDB entry) |
![]() | Domain d1qora2: 1qor A:113-291 [29782] Other proteins in same PDB: d1qora1, d1qorb1 complexed with ndp, so4 |
PDB Entry: 1qor (more details), 2.2 Å
SCOPe Domain Sequences for d1qora2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} isfeqaaasflkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtv gtaqkaqsalkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrr glmvsfgnssgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgv
Timeline for d1qora2: