PDB entry 1qor

View 1qor on RCSB PDB site
Description: crystal structure of escherichia coli quinone oxidoreductase complexed with nadph
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1995-02-14, released 1995-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinone oxidoreductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qora1, d1qora2
  • Chain 'B':
    Compound: quinone oxidoreductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qorb1, d1qorb2
  • Heterogens: SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qorA (A:)
    matriefhkhggpevlqaveftpadpaeneiqvenkaiginfidtyirsglypppslpsg
    lgteaagivskvgsgvkhikagdrvvyaqsalgayssvhniiadkaailpaaisfeqaaa
    sflkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqs
    alkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgn
    ssgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgvikvdvaeqq
    kyplkdaqraheilesratqgssllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qorA (A:)
    atriefhkhggpevlqaveftpadpaeneiqvenkaiginfidtyirsglypppslpsgl
    gteaagivskvgsgvkhikagdrvvyaqsalgayssvhniiadkaailpaaisfeqaaas
    flkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqsa
    lkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgns
    sgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgvikvdvaeqqk
    yplkdaqraheilesratqgssllip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qorB (B:)
    matriefhkhggpevlqaveftpadpaeneiqvenkaiginfidtyirsglypppslpsg
    lgteaagivskvgsgvkhikagdrvvyaqsalgayssvhniiadkaailpaaisfeqaaa
    sflkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqs
    alkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgn
    ssgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgvikvdvaeqq
    kyplkdaqraheilesratqgssllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qorB (B:)
    atriefhkhggpevlqaveftpadpaeneiqvenkaiginfidtyirsglypppslpsgl
    gteaagivskvgsgvkhikagdrvvyaqsalgayssvhniiadkaailpaaisfeqaaas
    flkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqsa
    lkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgns
    sgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgvikvdvaeqqk
    yplkdaqraheilesratqgssllip