Lineage for d1qora2 (1qor A:136-265)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 19979Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 20096Protein Quinone oxidoreductase [51747] (1 species)
  7. 20097Species Escherichia coli [TaxId:562] [51748] (1 PDB entry)
  8. 20098Domain d1qora2: 1qor A:136-265 [29782]
    Other proteins in same PDB: d1qora1, d1qorb1

Details for d1qora2

PDB Entry: 1qor (more details), 2.2 Å

PDB Description: crystal structure of escherichia coli quinone oxidoreductase complexed with nadph

SCOP Domain Sequences for d1qora2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qora2 c.2.1.1 (A:136-265) Quinone oxidoreductase {Escherichia coli}
yeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqsalkagawqvinyree
dlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgnssgavtgvnlgilnq
kgslyvtrps

SCOP Domain Coordinates for d1qora2:

Click to download the PDB-style file with coordinates for d1qora2.
(The format of our PDB-style files is described here.)

Timeline for d1qora2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qora1