Lineage for d1d1tc2 (1d1t C:163-338)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841027Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2841162Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2841193Domain d1d1tc2: 1d1t C:163-338 [29737]
    Other proteins in same PDB: d1d1ta1, d1d1tb1, d1d1tc1, d1d1td1
    sigma isozyme
    complexed with act, cac, nad, zn; mutant

Details for d1d1tc2

PDB Entry: 1d1t (more details), 2.4 Å

PDB Description: mutant of human sigma alcohol dehydrogenase with leucine at position 141
PDB Compounds: (C:) alcohol dehydrogenase class IV sigma chain

SCOPe Domain Sequences for d1d1tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1tc2 c.2.1.1 (C:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
aappekvcligcgfstgygaavktgkvkpgstcvvfglggvglsvimgcksagasriigi
dlnkdkfekamavgatecispkdstkpisevlsemtgnnvgytfevighletmidalasc
hmnygtsvvvgvppsakmltydpmllftgrtwkgcvfgglksrddvpklvteflak

SCOPe Domain Coordinates for d1d1tc2:

Click to download the PDB-style file with coordinates for d1d1tc2.
(The format of our PDB-style files is described here.)

Timeline for d1d1tc2: