SCOPe 2.08: Domain d1d1td2: 1d1t D:163-338

Lineage for d1d1td2 (1d1t D:163-338)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1d1td2: 1d1t D:163-338 [29738]
   Other proteins in same PDB: d1d1ta1, d1d1tb1, d1d1tc1, d1d1td1
   sigma isozyme
   complexed with act, cac, nad, zn; mutant

Details for d1d1td2

PDB Entry: 1d1t, 2.4 Å

PDB Description: mutant of human sigma alcohol dehydrogenase with leucine at position 141

PDB Compounds: (D:) alcohol dehydrogenase class IV sigma chain

SCOPe Domain Sequences for d1d1td2:

Sequence; same for both SEQRES and ATOM records:

>d1d1td2 c.2.1.1 (D:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
aappekvcligcgfstgygaavktgkvkpgstcvvfglggvglsvimgcksagasriigi
dlnkdkfekamavgatecispkdstkpisevlsemtgnnvgytfevighletmidalasc
hmnygtsvvvgvppsakmltydpmllftgrtwkgcvfgglksrddvpklvteflak

Timeline for d1d1td2:

• d1d1td2 first appeared (with stable ids) in SCOP 1.55
  
• d1d1td2 appears in SCOPe 2.07