Lineage for d3wwkf_ (3wwk F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608570Domain d3wwkf_: 3wwk F: [296134]
    Other proteins in same PDB: d3wwka_, d3wwkb_, d3wwkd_, d3wwkg_, d3wwkh_, d3wwkj_, d3wwkk_
    automated match to d2ziba_

Details for d3wwkf_

PDB Entry: 3wwk (more details), 2.98 Å

PDB Description: crystal structure of clec-2 in complex with rhodocytin
PDB Compounds: (F:) C-type lectin domain family 1 member B

SCOPe Domain Sequences for d3wwkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wwkf_ d.169.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
ag

SCOPe Domain Coordinates for d3wwkf_:

Click to download the PDB-style file with coordinates for d3wwkf_.
(The format of our PDB-style files is described here.)

Timeline for d3wwkf_: