| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
| Protein automated matches [190159] (20 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries) |
| Domain d3wwkf_: 3wwk F: [296134] Other proteins in same PDB: d3wwka_, d3wwkb_, d3wwkd_, d3wwkg_, d3wwkh_, d3wwkj_, d3wwkk_ automated match to d2ziba_ |
PDB Entry: 3wwk (more details), 2.98 Å
SCOPe Domain Sequences for d3wwkf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wwkf_ d.169.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
ag
Timeline for d3wwkf_: