![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (20 species) not a true protein |
![]() | Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [260627] (1 PDB entry) |
![]() | Domain d3wwke_: 3wwk E: [260628] Other proteins in same PDB: d3wwka_, d3wwkb_, d3wwkd_, d3wwkg_, d3wwkh_, d3wwkj_, d3wwkk_ automated match to d4pp8a_ |
PDB Entry: 3wwk (more details), 2.98 Å
SCOPe Domain Sequences for d3wwke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wwke_ d.169.1.0 (E:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck fka
Timeline for d3wwke_: